| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342818.1 | 3prime_partial | 233 | 129-827(+) |
Amino Acid sequence : | |||
| MRGSICDSGTVEIIGPITSNVEDAILVYAAILGSSSAVKIALKPSPPCLPNLTSNESTHVLGSLRLGKYTEWFNDVFSTEISVKCEDVINLLLENHGCKLVEIVIPELHELRTAHVVSIG SESACGFNPDYEDGKKAKFSLDTRTNLALFQTFSASDYVAAQCLRRRLMYYHMEIFKDVDVIVTPTTGMTAPVIPPAALSLGETNMQVTGYLMRFVVTANLLGFPCISVPIGY | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 13,876.250 | ||
| Theoretical pI: | 4.686 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 39.784 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.305 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342818.1 | complete | 128 | 394-8(-) |
Amino Acid sequence : | |||
| MTSSHFTDISVEKTSLNHSVYFPSLNDPRTCVLSFEVKLGKQGGDGFKAIFTADEDPRIAAYTSIASSTFEVMGPIISTVPESHIEPLISVLPYVDFSPTTPHREDGIRTEPPPSDGNAA EHNPEATI* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 13,876.250 | ||
| Theoretical pI: | 4.686 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 39.784 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.305 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342818.1 | 3prime_partial | 233 | 129-827(+) |
Amino Acid sequence : | |||
| MRGSICDSGTVEIIGPITSNVEDAILVYAAILGSSSAVKIALKPSPPCLPNLTSNESTHVLGSLRLGKYTEWFNDVFSTEISVKCEDVINLLLENHGCKLVEIVIPELHELRTAHVVSIG SESACGFNPDYEDGKKAKFSLDTRTNLALFQTFSASDYVAAQCLRRRLMYYHMEIFKDVDVIVTPTTGMTAPVIPPAALSLGETNMQVTGYLMRFVVTANLLGFPCISVPIGY | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 13,876.250 | ||
| Theoretical pI: | 4.686 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 39.784 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.305 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342818.1 | complete | 128 | 394-8(-) |
Amino Acid sequence : | |||
| MTSSHFTDISVEKTSLNHSVYFPSLNDPRTCVLSFEVKLGKQGGDGFKAIFTADEDPRIAAYTSIASSTFEVMGPIISTVPESHIEPLISVLPYVDFSPTTPHREDGIRTEPPPSDGNAA EHNPEATI* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 13,876.250 | ||
| Theoretical pI: | 4.686 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 39.784 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.305 | ||
| sheet | 0.203 | ||