| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342828.1 | internal | 249 | 3-749(+) |
Amino Acid sequence : | |||
| TPVFERIPKKQGVKDRGRGSMQREGVNIPVPEIKFTKLFINGSFIDSISGKTFETIDPRTEQVIVNVAEGDKEDVDLAVKAAREAFDHGPWPRLPGSERRRIMLRFADLIEEHAGELAAL EAMDAGKLYERNKTIEIPGAAETIRYFAGAADKIHGDTLKMSREMQAYTLCEPIGVVGHIIPWNFPTQMFVMKVGPSLAAGCTMVLKPAEQTPLSALLYAHLASRAGIPDGVLNVVTGYG HTAGAAITS | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 14,948.837 | ||
| Theoretical pI: | 9.828 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15845 | ||
| Instability index: | 64.946 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.295 | ||
| sheet | 0.167 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342828.1 | 5prime_partial | 132 | 749-351(-) |
Amino Acid sequence : | |||
| RSNSSTRCMAIPCHNIQHSIRNSSSRGQMSVEKCRKRRLLSWLEDHGAAGSQGRANFHNKHLSGEVPGNNVADDADGFTQSVGLHLPRHLQCVSVYFVGRPRKVSYCLRSPWDFYCLVPL VQLSSIHRFQRC* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,948.837 | ||
| Theoretical pI: | 9.828 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15845 | ||
| Instability index: | 64.946 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.295 | ||
| sheet | 0.167 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342828.1 | internal | 249 | 3-749(+) |
Amino Acid sequence : | |||
| TPVFERIPKKQGVKDRGRGSMQREGVNIPVPEIKFTKLFINGSFIDSISGKTFETIDPRTEQVIVNVAEGDKEDVDLAVKAAREAFDHGPWPRLPGSERRRIMLRFADLIEEHAGELAAL EAMDAGKLYERNKTIEIPGAAETIRYFAGAADKIHGDTLKMSREMQAYTLCEPIGVVGHIIPWNFPTQMFVMKVGPSLAAGCTMVLKPAEQTPLSALLYAHLASRAGIPDGVLNVVTGYG HTAGAAITS | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 14,948.837 | ||
| Theoretical pI: | 9.828 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15845 | ||
| Instability index: | 64.946 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.295 | ||
| sheet | 0.167 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342828.1 | 5prime_partial | 132 | 749-351(-) |
Amino Acid sequence : | |||
| RSNSSTRCMAIPCHNIQHSIRNSSSRGQMSVEKCRKRRLLSWLEDHGAAGSQGRANFHNKHLSGEVPGNNVADDADGFTQSVGLHLPRHLQCVSVYFVGRPRKVSYCLRSPWDFYCLVPL VQLSSIHRFQRC* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,948.837 | ||
| Theoretical pI: | 9.828 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15845 | ||
| Instability index: | 64.946 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.295 | ||
| sheet | 0.167 | ||