| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342832.1 | internal | 234 | 3-704(+) |
Amino Acid sequence : | |||
| FSPHHIFHNLHFRISCSTSTMISSLKPPSAHLTPPSKAYASDVLGSGRRFAAWSPLPPLAPARMRLLSVASLSRPLHISKGLERKERSPITCAAYEADRSEPVGEAAAAAARSESARKVK IGIYFATWWGLNVIFNIYNKKVLNAYPFPWLTSTLSLAAGSLIMLISWALRIAETPKTDLEFWKSLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFILGES | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 25,525.379 | ||
| Theoretical pI: | 10.053 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40575 | ||
| Instability index: | 50.596 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.269 | ||
| sheet | 0.286 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342832.1 | internal | 234 | 3-704(+) |
Amino Acid sequence : | |||
| FSPHHIFHNLHFRISCSTSTMISSLKPPSAHLTPPSKAYASDVLGSGRRFAAWSPLPPLAPARMRLLSVASLSRPLHISKGLERKERSPITCAAYEADRSEPVGEAAAAAARSESARKVK IGIYFATWWGLNVIFNIYNKKVLNAYPFPWLTSTLSLAAGSLIMLISWALRIAETPKTDLEFWKSLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFILGES | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 25,525.379 | ||
| Theoretical pI: | 10.053 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40575 | ||
| Instability index: | 50.596 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.269 | ||
| sheet | 0.286 | ||