| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342834.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
| VTTGSGATSHRRTKQGGALQKELIRFLNAGIFGKGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEALAKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSRAVAPTG TELNAEEAFKLAGINGGFFELQPKEGLALVNGTAVGSGLASIALYEANILSVLSVVISAIFAEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPKQD RYAL | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 26,012.666 | ||
| Theoretical pI: | 8.857 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 35.331 | ||
| aromaticity | 0.057 | ||
| GRAVY | 0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.242 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342834.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
| VTTGSGATSHRRTKQGGALQKELIRFLNAGIFGKGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEALAKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSRAVAPTG TELNAEEAFKLAGINGGFFELQPKEGLALVNGTAVGSGLASIALYEANILSVLSVVISAIFAEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPKQD RYAL | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 26,012.666 | ||
| Theoretical pI: | 8.857 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 35.331 | ||
| aromaticity | 0.057 | ||
| GRAVY | 0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.242 | ||
| sheet | 0.324 | ||