Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342854.1 | 5prime_partial | 186 | 2-562(+) |
Amino Acid sequence : | |||
HPCYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLDWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHTAECSSCSVA CKRLNALEIGLQAMSLVFVAMAAAVSAPATRYSMVAMAVLSFLASKWLSHFIHKTFYNHGYDHAFV* | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 21,402.368 | ||
Theoretical pI: | 9.012 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44920 45170 | ||
Instability index: | 58.202 | ||
aromaticity | 0.140 | ||
GRAVY | -0.073 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.194 | ||
sheet | 0.253 |