Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342860.1	5prime_partial	245	1-738(+)
Amino Acid sequence :
ARGYTPHTHNPSAMSSTALSQTFFSLKSSADSPISNIGICAQSPFSVSVKRSFSVSKSDVISTPIRKIRPSFVVCSASTSDNGSSEETPIELKYPAFPTVMDINQIRDILPHRFPFLLVD RVIEYTPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQPEVGGSRENFFFAGVDKVRFRKPVIAGDTLVMRMNLVKLQKRFGIAKMEGKAYVGGEVVCEGEFLMA MGNSN*
Physicochemical properties
Number of amino acids:		245
Molecular weight:		17,167.487
Theoretical pI:		10.786
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21345
Instability index:		70.435
aromaticity		0.068
GRAVY		-0.714
Secondary Structure Fraction
Helix		0.265
turn		0.224
sheet		0.177

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342860.1	3prime_partial	147	441-1(-)
Amino Acid sequence :
MPGKEIIIYCHILDSHSRHPRSVLNHSIHKQKWKSVRQNITNLINIHHRRKCRILQFNRCFFRGAVVAGGSGADDKTWADLPYRRGNHIGFGDAERSLDGNRERRLSANAYVRNWRVRRA LEGEESLRERCGRHCRRIVCVRSITAC
Physicochemical properties
Number of amino acids:		147
Molecular weight:		17,167.487
Theoretical pI:		10.786
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21345
Instability index:		70.435
aromaticity		0.068
GRAVY		-0.714
Secondary Structure Fraction
Helix		0.265
turn		0.224
sheet		0.177