Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342864.1 | 5prime_partial | 215 | 1-648(+) |
Amino Acid sequence : | |||
ALISAIPRHTDPSLSLPLLSFLLDIISCLIISEEMEAAEQLCYIPCNFCNIILAVSVPCSSLFDVVTVRCGHCTNLWNVNMAAAFQSLQPSCQDFQVPSYGSAEYRVDMGSSSRWNPRMQ IQPPTFINRLVNRPPEKRQRVPSAYNQFIKEEIQRIKAKNPDISHREAFSTAAKNWAHFPHIHFGLMLESNNNQPKPINEGSDKHQMRRAAVLNK* | |||
Physicochemical properties | |||
Number of amino acids: | 215 | ||
Molecular weight: | 17,277.284 | ||
Theoretical pI: | 9.399 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 48.366 | ||
aromaticity | 0.066 | ||
GRAVY | 0.228 | ||
Secondary Structure Fraction | |||
Helix | 0.382 | ||
turn | 0.257 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342864.1 | 5prime_partial | 152 | 762-304(-) |
Amino Acid sequence : | |||
SKCNNIKKIMIIIIIKCLNFFRLAIVVIGNGEDDHRDGLFVQNGCPSHLMLVRPLVNWFRLIVIALQHESKMDMRKMCPIFGSSAESFPVANIWILGLDSLNLLLNELIVCRWNTLPLLR RTIHKSVDESGRLDLHSRVPSRGGPHVHSVFS* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,277.284 | ||
Theoretical pI: | 9.399 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 48.366 | ||
aromaticity | 0.066 | ||
GRAVY | 0.228 | ||
Secondary Structure Fraction | |||
Helix | 0.382 | ||
turn | 0.257 | ||
sheet | 0.224 |