Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342865.1 | 5prime_partial | 172 | 663-145(-) |
Amino Acid sequence : | |||
IPCNFCNIILAVSVPCSSLFDVVTVRCGHCTNLWNVNMAAAFQSLQPSCQDFQVPSYGSAEYRVDMGSSSRWNPRMQIQPPTFINRLVNRPPEKRQRVPSAYNQFIKEEIQRIKAKNPDI SHREAFSTAAKNWAHFPHIHFGLMLESNNNQPKPINEGSDKHQMRRAAVLNK* | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 16,248.027 | ||
Theoretical pI: | 8.882 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 48.895 | ||
aromaticity | 0.070 | ||
GRAVY | 0.299 | ||
Secondary Structure Fraction | |||
Helix | 0.392 | ||
turn | 0.252 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342865.1 | complete | 143 | 58-489(+) |
Amino Acid sequence : | |||
MIIIIIKCLNFFRLAIVVIGNGEDDHRDGLFVQNGCPSHLMLVRPLVNWFRLIVIALQHESKMDMRKMCPIFGSSAESFPVANIWILGLDSLNLLLNELIVCRWNTLPLLRRTIHKSVDE SGRLDLHSRVPSRGGPHVHSVFS* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 16,248.027 | ||
Theoretical pI: | 8.882 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 48.895 | ||
aromaticity | 0.070 | ||
GRAVY | 0.299 | ||
Secondary Structure Fraction | |||
Helix | 0.392 | ||
turn | 0.252 | ||
sheet | 0.238 |