| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342881.1 | 5prime_partial | 244 | 803-69(-) |
Amino Acid sequence : | |||
| PEDEAAGSSGSFFGRNILPHLQNNQVRRRPDPMVVATKLLGRRKLIDTGKQFNMIAASWIQFMIHDWVDHLENLQQQVELSAPEEVASLCPLKSFKFYKSKEIEIVDGDNGIQTGFLNRR TPWWDGSAIYGSDRETLQKVRTFRDGKLKISDDGLIPVGEDGVVLTGDVRNVWAGLTALQALFVKEHNAVCDALLKEYPAMGDEELYRHARLVTSAVIAKIHTIDWTVELLKTDMLRAGM RGNW* | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 18,898.598 | ||
| Theoretical pI: | 9.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.090 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.262 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342881.1 | complete | 164 | 177-671(+) |
Amino Acid sequence : | |||
| MPIQFLISHRRIFLQESIAHCIVFFNKEGLQGRKPGPHIPNIAGQNDTVFAHRNKPVVGDLQLTIPESPYFLQSFSIAPINRASIPPRRSPVQEAGLNPVITVHDFDLFRLVEFKRFERA EARNFFRSTKLNLLLKIFEMIDPIMNHELNPRSSNHVELFSSID* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 18,898.598 | ||
| Theoretical pI: | 9.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.090 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.262 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342881.1 | 5prime_partial | 244 | 803-69(-) |
Amino Acid sequence : | |||
| PEDEAAGSSGSFFGRNILPHLQNNQVRRRPDPMVVATKLLGRRKLIDTGKQFNMIAASWIQFMIHDWVDHLENLQQQVELSAPEEVASLCPLKSFKFYKSKEIEIVDGDNGIQTGFLNRR TPWWDGSAIYGSDRETLQKVRTFRDGKLKISDDGLIPVGEDGVVLTGDVRNVWAGLTALQALFVKEHNAVCDALLKEYPAMGDEELYRHARLVTSAVIAKIHTIDWTVELLKTDMLRAGM RGNW* | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 18,898.598 | ||
| Theoretical pI: | 9.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.090 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.262 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342881.1 | complete | 164 | 177-671(+) |
Amino Acid sequence : | |||
| MPIQFLISHRRIFLQESIAHCIVFFNKEGLQGRKPGPHIPNIAGQNDTVFAHRNKPVVGDLQLTIPESPYFLQSFSIAPINRASIPPRRSPVQEAGLNPVITVHDFDLFRLVEFKRFERA EARNFFRSTKLNLLLKIFEMIDPIMNHELNPRSSNHVELFSSID* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 18,898.598 | ||
| Theoretical pI: | 9.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.090 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.262 | ||
| sheet | 0.220 | ||