Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342885.1 | complete | 157 | 123-596(+) |
Amino Acid sequence : | |||
MSHNFIFDSDLFLLHVEEQKLKDLDWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHTAECSSCSVACKRLNALEIGLQAMSLVFVAMAAAVSAPA TRYSMVAMAVLSFLASKWLSHFIHKTFYNHGYDHAFV* | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 17,966.408 | ||
Theoretical pI: | 8.367 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36690 | ||
Instability index: | 60.874 | ||
aromaticity | 0.140 | ||
GRAVY | -0.065 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.197 | ||
sheet | 0.268 |