Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342888.1 | internal | 238 | 2-715(+) |
Amino Acid sequence : | |||
HPLRLHRMFAGAGGALGHPPPDSPTLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFG CWLSGVDINTQQSFEALNQRAVAVVVDPIQSVKGKVVIDAFRLINPQTMMLGQEPRQTTSNVGHLNKPSIQALIHGLNRHYYSIAINYRKNELEEKMLLNLHKKKWTDGLTLQRFDTH | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 11,616.519 | ||
Theoretical pI: | 8.003 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 34.842 | ||
aromaticity | 0.129 | ||
GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.446 | ||
turn | 0.248 | ||
sheet | 0.228 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342888.1 | complete | 111 | 343-8(-) |
Amino Acid sequence : | |||
MVPTNNHLRSASLLKHVKHISLENVIDRLYTDTGSTLRHRKNVHHTHRVLVHKLPQHQPHDLHRHSSPAVFEHFKEGERRDIDLFGGVEGRRVRRRVAEGAACAGKHPVKS* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,616.519 | ||
Theoretical pI: | 8.003 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 34.842 | ||
aromaticity | 0.129 | ||
GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.446 | ||
turn | 0.248 | ||
sheet | 0.228 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342888.1 | 5prime_partial | 101 | 715-410(-) |
Amino Acid sequence : | |||
VGVKPLEGQSICPFLFVKIQEHLLLKLVLPVINGYGVIMPVQPMNQSLNRWFIKVAYIRSSLAWFLTQHHGLGVDEAEGINYHLSFNTLNWIYHHSYCPLI* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,616.519 | ||
Theoretical pI: | 8.003 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 34.842 | ||
aromaticity | 0.129 | ||
GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.446 | ||
turn | 0.248 | ||
sheet | 0.228 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342888.1 | internal | 238 | 2-715(+) |
Amino Acid sequence : | |||
HPLRLHRMFAGAGGALGHPPPDSPTLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFG CWLSGVDINTQQSFEALNQRAVAVVVDPIQSVKGKVVIDAFRLINPQTMMLGQEPRQTTSNVGHLNKPSIQALIHGLNRHYYSIAINYRKNELEEKMLLNLHKKKWTDGLTLQRFDTH | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 11,616.519 | ||
Theoretical pI: | 8.003 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 34.842 | ||
aromaticity | 0.129 | ||
GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.446 | ||
turn | 0.248 | ||
sheet | 0.228 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342888.1 | complete | 111 | 343-8(-) |
Amino Acid sequence : | |||
MVPTNNHLRSASLLKHVKHISLENVIDRLYTDTGSTLRHRKNVHHTHRVLVHKLPQHQPHDLHRHSSPAVFEHFKEGERRDIDLFGGVEGRRVRRRVAEGAACAGKHPVKS* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,616.519 | ||
Theoretical pI: | 8.003 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 34.842 | ||
aromaticity | 0.129 | ||
GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.446 | ||
turn | 0.248 | ||
sheet | 0.228 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342888.1 | 5prime_partial | 101 | 715-410(-) |
Amino Acid sequence : | |||
VGVKPLEGQSICPFLFVKIQEHLLLKLVLPVINGYGVIMPVQPMNQSLNRWFIKVAYIRSSLAWFLTQHHGLGVDEAEGINYHLSFNTLNWIYHHSYCPLI* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,616.519 | ||
Theoretical pI: | 8.003 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 34.842 | ||
aromaticity | 0.129 | ||
GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.446 | ||
turn | 0.248 | ||
sheet | 0.228 |