| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342888.1 | internal | 238 | 2-715(+) |
Amino Acid sequence : | |||
| HPLRLHRMFAGAGGALGHPPPDSPTLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFG CWLSGVDINTQQSFEALNQRAVAVVVDPIQSVKGKVVIDAFRLINPQTMMLGQEPRQTTSNVGHLNKPSIQALIHGLNRHYYSIAINYRKNELEEKMLLNLHKKKWTDGLTLQRFDTH | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 11,616.519 | ||
| Theoretical pI: | 8.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 34.842 | ||
| aromaticity | 0.129 | ||
| GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.446 | ||
| turn | 0.248 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342888.1 | complete | 111 | 343-8(-) |
Amino Acid sequence : | |||
| MVPTNNHLRSASLLKHVKHISLENVIDRLYTDTGSTLRHRKNVHHTHRVLVHKLPQHQPHDLHRHSSPAVFEHFKEGERRDIDLFGGVEGRRVRRRVAEGAACAGKHPVKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 11,616.519 | ||
| Theoretical pI: | 8.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 34.842 | ||
| aromaticity | 0.129 | ||
| GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.446 | ||
| turn | 0.248 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342888.1 | 5prime_partial | 101 | 715-410(-) |
Amino Acid sequence : | |||
| VGVKPLEGQSICPFLFVKIQEHLLLKLVLPVINGYGVIMPVQPMNQSLNRWFIKVAYIRSSLAWFLTQHHGLGVDEAEGINYHLSFNTLNWIYHHSYCPLI* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,616.519 | ||
| Theoretical pI: | 8.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 34.842 | ||
| aromaticity | 0.129 | ||
| GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.446 | ||
| turn | 0.248 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342888.1 | internal | 238 | 2-715(+) |
Amino Acid sequence : | |||
| HPLRLHRMFAGAGGALGHPPPDSPTLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFG CWLSGVDINTQQSFEALNQRAVAVVVDPIQSVKGKVVIDAFRLINPQTMMLGQEPRQTTSNVGHLNKPSIQALIHGLNRHYYSIAINYRKNELEEKMLLNLHKKKWTDGLTLQRFDTH | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 11,616.519 | ||
| Theoretical pI: | 8.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 34.842 | ||
| aromaticity | 0.129 | ||
| GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.446 | ||
| turn | 0.248 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342888.1 | complete | 111 | 343-8(-) |
Amino Acid sequence : | |||
| MVPTNNHLRSASLLKHVKHISLENVIDRLYTDTGSTLRHRKNVHHTHRVLVHKLPQHQPHDLHRHSSPAVFEHFKEGERRDIDLFGGVEGRRVRRRVAEGAACAGKHPVKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 11,616.519 | ||
| Theoretical pI: | 8.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 34.842 | ||
| aromaticity | 0.129 | ||
| GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.446 | ||
| turn | 0.248 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342888.1 | 5prime_partial | 101 | 715-410(-) |
Amino Acid sequence : | |||
| VGVKPLEGQSICPFLFVKIQEHLLLKLVLPVINGYGVIMPVQPMNQSLNRWFIKVAYIRSSLAWFLTQHHGLGVDEAEGINYHLSFNTLNWIYHHSYCPLI* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,616.519 | ||
| Theoretical pI: | 8.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 34.842 | ||
| aromaticity | 0.129 | ||
| GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.446 | ||
| turn | 0.248 | ||
| sheet | 0.228 | ||