| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342894.1 | complete | 127 | 153-536(+) |
Amino Acid sequence : | |||
| MQKLRQVLVNHALANVEAEKELATSIFLKIGEFEEELKALLPKEVEKVRAEFETKKASIENRIKNCRSYPLYRFVREVAGTDFLTGEKARSPGEEFDKVFTAICEGKLIDPLLDCLKEWN GAPLPIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,298.860 | ||
| Theoretical pI: | 10.658 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 54.152 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.369 | ||
| sheet | 0.213 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342894.1 | complete | 122 | 550-182(-) |
Amino Acid sequence : | |||
| MIIFHQHIGRGAPFHSLRQSNNGSINFPSQIAVNTLSNSSPGERAFSPVKKSVPATSLTNLYKGYDLQFLILFSMEAFLVSNSARTFSTSLGRRAFNSSSNSPIFKKMEVANSFSASTFA NA* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,298.860 | ||
| Theoretical pI: | 10.658 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 54.152 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.369 | ||
| sheet | 0.213 | ||