Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342907.1 | 5prime_partial | 168 | 3-509(+) |
Amino Acid sequence : | |||
YQEMGFLYHAIKVPKLLTLSFFLNLIAHAHYLFIGALTRLGLYKPPPEESPESTATPNNYILIFDSSSPSLVPIPVHVVTAAIKKRVPVVEYQELVGRRVEEEGCGGACSICLENIEERD EVRELCNCRHLFHRACLDTWIDEGQVSCPLCRSMLLPPKQIIKSMVAC* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 12,300.410 | ||
Theoretical pI: | 4.160 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 62.489 | ||
aromaticity | 0.079 | ||
GRAVY | -0.265 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.228 | ||
sheet | 0.307 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342907.1 | 5prime_partial | 120 | 2-364(+) |
Amino Acid sequence : | |||
ISGNGFPLPRHKSAQTPHPILLPQPHRPRPLPLHRRPHASRPLQTAAGGVAGIHRHSQQLHPHIRLLLPLARPHPRPRRHRRNQKASPRSGVPGTRRTARRGGRVRRRVQYLLGEYRGKG * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 12,300.410 | ||
Theoretical pI: | 4.160 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 62.489 | ||
aromaticity | 0.079 | ||
GRAVY | -0.265 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.228 | ||
sheet | 0.307 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342907.1 | complete | 114 | 401-57(-) |
Amino Acid sequence : | |||
MKQMPTIAQLPHLIPFLYILQANTARAAAPFLLDAPSDEFLVLHYGDSLFDCGGDDVDGDGDERGGGGVEYEDVVVGSGGGFRRLLRRRFVEAETREGADEEVVGVGDEVEEEG* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,300.410 | ||
Theoretical pI: | 4.160 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 62.489 | ||
aromaticity | 0.079 | ||
GRAVY | -0.265 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.228 | ||
sheet | 0.307 |