| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342907.1 | 5prime_partial | 168 | 3-509(+) |
Amino Acid sequence : | |||
| YQEMGFLYHAIKVPKLLTLSFFLNLIAHAHYLFIGALTRLGLYKPPPEESPESTATPNNYILIFDSSSPSLVPIPVHVVTAAIKKRVPVVEYQELVGRRVEEEGCGGACSICLENIEERD EVRELCNCRHLFHRACLDTWIDEGQVSCPLCRSMLLPPKQIIKSMVAC* | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 12,300.410 | ||
| Theoretical pI: | 4.160 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 62.489 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.265 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.228 | ||
| sheet | 0.307 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342907.1 | 5prime_partial | 120 | 2-364(+) |
Amino Acid sequence : | |||
| ISGNGFPLPRHKSAQTPHPILLPQPHRPRPLPLHRRPHASRPLQTAAGGVAGIHRHSQQLHPHIRLLLPLARPHPRPRRHRRNQKASPRSGVPGTRRTARRGGRVRRRVQYLLGEYRGKG * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,300.410 | ||
| Theoretical pI: | 4.160 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 62.489 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.265 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.228 | ||
| sheet | 0.307 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342907.1 | complete | 114 | 401-57(-) |
Amino Acid sequence : | |||
| MKQMPTIAQLPHLIPFLYILQANTARAAAPFLLDAPSDEFLVLHYGDSLFDCGGDDVDGDGDERGGGGVEYEDVVVGSGGGFRRLLRRRFVEAETREGADEEVVGVGDEVEEEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,300.410 | ||
| Theoretical pI: | 4.160 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 62.489 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.265 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.228 | ||
| sheet | 0.307 | ||