| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342915.1 | internal | 107 | 1-321(+) |
Amino Acid sequence : | |||
| ASPPAALDYYYAETAVSRSLTKDNLGAFVLLQGAQRGPSACITAQGLKSRERPGVEELGSDPLYEDPIFTKKVFRDAMACHARLTTSAVIENYGEGFTGVGSLVDVG | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,356.627 | ||
| Theoretical pI: | 5.019 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 47.897 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.252 | ||
| sheet | 0.290 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342915.1 | internal | 107 | 1-321(+) |
Amino Acid sequence : | |||
| ASPPAALDYYYAETAVSRSLTKDNLGAFVLLQGAQRGPSACITAQGLKSRERPGVEELGSDPLYEDPIFTKKVFRDAMACHARLTTSAVIENYGEGFTGVGSLVDVG | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,356.627 | ||
| Theoretical pI: | 5.019 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 47.897 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.252 | ||
| sheet | 0.290 | ||