| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342918.1 | 5prime_partial | 142 | 3-431(+) |
Amino Acid sequence : | |||
| LFPDPLEMASVTAPTVNFSSVSCLVKQNQASNLKKTSLSFSGKAFQSRRLPALRFRVACAAKPETVDKVVDIVRKQLALAEDRVVNGESKFSTLGADSLDTVEIVMGLEEEFGICVEEES AQSISTVQEAADLIETLLEKKC* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,411.457 | ||
| Theoretical pI: | 4.849 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
| Instability index: | 46.973 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.007 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.204 | ||
| sheet | 0.317 | ||