| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342925.1 | 5prime_partial | 202 | 695-87(-) |
Amino Acid sequence : | |||
| VHESIADAFLERLVKWCENIKISNPLEEGCRLGPVVSVGQYEKVLKFISPAKEEGATILCGGSRPQHLKKGYFIQPTVITNVNTSMQIWRDEVFGPVFWVKTFAIEEEAIELANDTQYGW GFAVLSQDLERCEGLIKAFQSGIVGVNCFQPCFAQAPWGGRKRSGFGRELGEWGLENYLNRKQVTQYIFEEAWGWYKAPFKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 22,946.984 | ||
| Theoretical pI: | 5.834 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 52940 53315 | ||
| Instability index: | 33.751 | ||
| aromaticity | 0.134 | ||
| GRAVY | -0.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.228 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342925.1 | 5prime_partial | 202 | 695-87(-) |
Amino Acid sequence : | |||
| VHESIADAFLERLVKWCENIKISNPLEEGCRLGPVVSVGQYEKVLKFISPAKEEGATILCGGSRPQHLKKGYFIQPTVITNVNTSMQIWRDEVFGPVFWVKTFAIEEEAIELANDTQYGW GFAVLSQDLERCEGLIKAFQSGIVGVNCFQPCFAQAPWGGRKRSGFGRELGEWGLENYLNRKQVTQYIFEEAWGWYKAPFKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 22,946.984 | ||
| Theoretical pI: | 5.834 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 52940 53315 | ||
| Instability index: | 33.751 | ||
| aromaticity | 0.134 | ||
| GRAVY | -0.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.228 | ||
| sheet | 0.243 | ||