| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342928.1 | internal | 280 | 3-842(+) |
Amino Acid sequence : | |||
| QQSPDIAQGVHCHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKP VIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLI KENFDFRPGMMAINLDLLRGGNFRYQKTAAYGHFGRDDPD | |||
Physicochemical properties | |||
| Number of amino acids: | 280 | ||
| Molecular weight: | 30,473.326 | ||
| Theoretical pI: | 7.884 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
| Instability index: | 20.918 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.229 | ||
| sheet | 0.196 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342928.1 | internal | 280 | 3-842(+) |
Amino Acid sequence : | |||
| QQSPDIAQGVHCHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKP VIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLI KENFDFRPGMMAINLDLLRGGNFRYQKTAAYGHFGRDDPD | |||
Physicochemical properties | |||
| Number of amino acids: | 280 | ||
| Molecular weight: | 30,473.326 | ||
| Theoretical pI: | 7.884 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
| Instability index: | 20.918 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.229 | ||
| sheet | 0.196 | ||