Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342930.1 | 5prime_partial | 182 | 2-550(+) |
Amino Acid sequence : | |||
YWLHLPGSDYHLLEAYKQRQIPLKITTLTSIRGSSHEVRMHIENTSKKPDSTILLQNSNAMKQGNRNLDMSMWRDREEKQKQGLIQKVMKNFSGEASRARVAEISGSETGVAFFLQLSVH ASKEDKKDDEDTRILPVHYSDNYFSVVPGEVMTVTLNFEVEEGVTPRIMMNGWNYQSGQTVV* | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 20,820.299 | ||
Theoretical pI: | 6.664 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 44.231 | ||
aromaticity | 0.077 | ||
GRAVY | -0.621 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.242 | ||
sheet | 0.236 |