| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342935.1 | complete | 232 | 1-699(+) |
Amino Acid sequence : | |||
| MDVTDSDHKPALCIFNVEIARVDESVRRQEFGEIIRSNDKVKRLLEELTKVPEAIVSTNNIILQNQDTSILRITNKCKKDKAIYEIFCEGLSTINDGQASDHRPRGSFGFPRWLQVNPAS GIIEADQIAEIAIRHEEFQTLEEFVDGVPQNFWCEDARDKEVMLVVKVRGSCTPEAKCHRIRVRYSITGKLTPMNRKVTNPITAPANLLRSNFHKLSGSCDVVDQLRNLYTP* | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 26,366.778 | ||
| Theoretical pI: | 6.535 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15845 | ||
| Instability index: | 47.526 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.418 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.211 | ||
| sheet | 0.216 | ||