| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342951.1 | complete | 142 | 60-488(+) |
Amino Acid sequence : | |||
| MGKTRGMGAGRKLKSHRRNQRWADKAYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFK VVKVSGVSLLALFKEKKEKPRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,676.179 | ||
| Theoretical pI: | 10.372 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 19.112 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.589 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.254 | ||
| sheet | 0.225 | ||