| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342953.1 | internal | 141 | 3-425(+) |
Amino Acid sequence : | |||
| AVGLPSDHLHRIMRFLAHHGVSKKTASPPGESDYYYAETAVSRSLTKDNLGPFVLLQGAQRGPSACITAQGLKSRERPGVEELGSDPLYEDPIFTEKVFRDAMTCHARVTTSVVIENYGE GFRGVGSLVDVGGSYGMSXGM | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,061.798 | ||
| Theoretical pI: | 6.214 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 40.624 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.272 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.286 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342953.1 | internal | 141 | 3-425(+) |
Amino Acid sequence : | |||
| AVGLPSDHLHRIMRFLAHHGVSKKTASPPGESDYYYAETAVSRSLTKDNLGPFVLLQGAQRGPSACITAQGLKSRERPGVEELGSDPLYEDPIFTEKVFRDAMTCHARVTTSVVIENYGE GFRGVGSLVDVGGSYGMSXGM | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,061.798 | ||
| Theoretical pI: | 6.214 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 40.624 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.272 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.286 | ||
| sheet | 0.243 | ||