| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342961.1 | 5prime_partial | 177 | 1-534(+) |
Amino Acid sequence : | |||
| VYLEEHFWIMERKLPTFKEYTKISQITALIFVIFIAVIPGLKSTTEETIQWLLSDSQIVSSVCVAGRLLDDLGTYQRERRDGKMLTIVDCYMKDRDVSEEEALSSFVEIIDDKWKHINAE WVKSRVVPNEMVEQFINMLRAAQMTYKNNEDGYSSPDQNSNLTPFISALLVDPPLLA* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 20,428.204 | ||
| Theoretical pI: | 4.746 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
| Instability index: | 37.426 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.186 | ||
| sheet | 0.266 | ||