Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342978.1	5prime_partial	218	2-658(+)
Amino Acid sequence :
SSTPLCPKPPKKGQPEDAVYDFEDKINFAPFPSLQGGPHNHQIGALAVALKQALSPGFKAYAKQVKANAVALGNYLMSKGYSLVTGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNK NAVFGDSSALAPGGVRIGAPAMTSRGLVEKDFEQIAEFLHRAVSLTLKIQKEHGKLLKDFNKGLVNNKEIEELKADVEKFSASFDMPGFLVSEMKYKD*
Physicochemical properties
Number of amino acids:		218
Molecular weight:		23,657.968
Theoretical pI:		8.627
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		42.987
aromaticity		0.078
GRAVY		-0.247
Secondary Structure Fraction
Helix		0.294
turn		0.261
sheet		0.284