| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342988.1 | 3prime_partial | 130 | 162-551(+) |
Amino Acid sequence : | |||
| MIDLCSLDPVFDGANFQVLTALANAFHAIQPLKVPGFSFAWLELISHRSFMPKLLTANAQKGWPYFQRLLVDLFQFMEPFLRNAELGEPVQFLYKGTLRVLLVLLHDFPEFLCDYHFSFC DVIPPSCIQM | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,972.434 | ||
| Theoretical pI: | 5.388 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 35.212 | ||
| aromaticity | 0.154 | ||
| GRAVY | 0.417 | ||
Secondary Structure Fraction | |||
| Helix | 0.415 | ||
| turn | 0.192 | ||
| sheet | 0.300 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342988.1 | 3prime_partial | 130 | 162-551(+) |
Amino Acid sequence : | |||
| MIDLCSLDPVFDGANFQVLTALANAFHAIQPLKVPGFSFAWLELISHRSFMPKLLTANAQKGWPYFQRLLVDLFQFMEPFLRNAELGEPVQFLYKGTLRVLLVLLHDFPEFLCDYHFSFC DVIPPSCIQM | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,972.434 | ||
| Theoretical pI: | 5.388 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 35.212 | ||
| aromaticity | 0.154 | ||
| GRAVY | 0.417 | ||
Secondary Structure Fraction | |||
| Helix | 0.415 | ||
| turn | 0.192 | ||
| sheet | 0.300 | ||