| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342989.1 | internal | 175 | 527-3(-) |
Amino Acid sequence : | |||
| TRPRAEFGTRQASSKLSLLPKVLAVTVKFILKDAEERKAAFHPRPYFRLFVNWMIDLCSLDPVFDGANFQVLTALANAFHAIQPLKVPGFSFAWLELISHRSFMPKLLTANAQKGWPYFQ RLLVDLFQFMEPFLRNAELGEPVQFLYKGTLRVLLVLLHDFPEFKGDYHFSFCDV | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 20,241.445 | ||
| Theoretical pI: | 9.169 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 27.995 | ||
| aromaticity | 0.154 | ||
| GRAVY | 0.128 | ||
Secondary Structure Fraction | |||
| Helix | 0.394 | ||
| turn | 0.183 | ||
| sheet | 0.297 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342989.1 | internal | 175 | 527-3(-) |
Amino Acid sequence : | |||
| TRPRAEFGTRQASSKLSLLPKVLAVTVKFILKDAEERKAAFHPRPYFRLFVNWMIDLCSLDPVFDGANFQVLTALANAFHAIQPLKVPGFSFAWLELISHRSFMPKLLTANAQKGWPYFQ RLLVDLFQFMEPFLRNAELGEPVQFLYKGTLRVLLVLLHDFPEFKGDYHFSFCDV | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 20,241.445 | ||
| Theoretical pI: | 9.169 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 27.995 | ||
| aromaticity | 0.154 | ||
| GRAVY | 0.128 | ||
Secondary Structure Fraction | |||
| Helix | 0.394 | ||
| turn | 0.183 | ||
| sheet | 0.297 | ||