| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343006.1 | 5prime_partial | 128 | 3-389(+) |
Amino Acid sequence : | |||
| LELETYPGVKRITTMPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERKSGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGP YKPLHYRY* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 12,855.686 | ||
| Theoretical pI: | 9.745 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
| Instability index: | 58.579 | ||
| aromaticity | 0.138 | ||
| GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.220 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343006.1 | complete | 109 | 241-570(+) |
Amino Acid sequence : | |||
| MCCRSTWMRRWQHFTWESWGRSSLSSPRIRLITSVFRWRDLTSLFTTDTDHNKQALSAICHCASLLLFEFSCHLGTPILWPIITKNIFSFASLLFHTNTTGISRHHWVN* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,855.686 | ||
| Theoretical pI: | 9.745 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
| Instability index: | 58.579 | ||
| aromaticity | 0.138 | ||
| GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.220 | ||
| sheet | 0.183 | ||