| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343016.1 | internal | 241 | 2-724(+) |
Amino Acid sequence : | |||
| GSKTRPLPLAAAGGGAGGGRFYDFGRPKLRLTSEYDSDSSVFFHKVSCKLMDNLAKLKLAFYNNNKGEVSEPQISFNSKFFSLQYDVEENDALLKTSFEIVPGVQLRAAHQVKSRQGEVA MVADLATPAYKLELASAVPSVGMPKATFKFPLGEVSLEDKEVEEEEEIQKKTLSVSGIVKSHILNGVCTARYDEENLNLRYAFKDEQMTLIPSISLPSNAFSCAFKRRFTPWDKLSYLYH F | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 12,451.120 | ||
| Theoretical pI: | 8.039 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.287 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.228 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.173 | ||
| sheet | 0.345 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343016.1 | 3prime_partial | 110 | 331-2(-) |
Amino Acid sequence : | |||
| MRSSQLNSGHDFERRLEQRIVLLDVVLQRKELRIERNLRLRHFPLVVVVERELQFSQIVHQFARHLVEEDRAVAVVLRREAELRPAEVIEPAASGAAACGGEGKGSGFAS | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,451.120 | ||
| Theoretical pI: | 8.039 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.287 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.228 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.173 | ||
| sheet | 0.345 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343016.1 | internal | 241 | 2-724(+) |
Amino Acid sequence : | |||
| GSKTRPLPLAAAGGGAGGGRFYDFGRPKLRLTSEYDSDSSVFFHKVSCKLMDNLAKLKLAFYNNNKGEVSEPQISFNSKFFSLQYDVEENDALLKTSFEIVPGVQLRAAHQVKSRQGEVA MVADLATPAYKLELASAVPSVGMPKATFKFPLGEVSLEDKEVEEEEEIQKKTLSVSGIVKSHILNGVCTARYDEENLNLRYAFKDEQMTLIPSISLPSNAFSCAFKRRFTPWDKLSYLYH F | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 12,451.120 | ||
| Theoretical pI: | 8.039 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.287 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.228 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.173 | ||
| sheet | 0.345 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343016.1 | 3prime_partial | 110 | 331-2(-) |
Amino Acid sequence : | |||
| MRSSQLNSGHDFERRLEQRIVLLDVVLQRKELRIERNLRLRHFPLVVVVERELQFSQIVHQFARHLVEEDRAVAVVLRREAELRPAEVIEPAASGAAACGGEGKGSGFAS | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,451.120 | ||
| Theoretical pI: | 8.039 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.287 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.228 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.173 | ||
| sheet | 0.345 | ||