| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343044.1 | internal | 233 | 1-699(+) |
Amino Acid sequence : | |||
| FHLARKYGPIMGLRFGFVPTLIVSSPSAAELVLKSHDHVFASRPSSKAAIYIGYNQMGLGTGPYSPYWRNMRKLSISHLLSSLKIAQFEPMRRAELGLMVSALERAAEDRETVDLSSTFS VLIGDMNSLMLFGRRFSDSKQNGFKDVMVETMELAGKFNLADYFPYVGALDLQGLHGRMKRVSKIYDEILEKIIDDHLLNKQETKKKAADFIDTLMEIMESGEAGFDFDRCHV | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 26,270.054 | ||
| Theoretical pI: | 7.230 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
| Instability index: | 32.192 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.223 | ||
| sheet | 0.296 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343044.1 | internal | 233 | 1-699(+) |
Amino Acid sequence : | |||
| FHLARKYGPIMGLRFGFVPTLIVSSPSAAELVLKSHDHVFASRPSSKAAIYIGYNQMGLGTGPYSPYWRNMRKLSISHLLSSLKIAQFEPMRRAELGLMVSALERAAEDRETVDLSSTFS VLIGDMNSLMLFGRRFSDSKQNGFKDVMVETMELAGKFNLADYFPYVGALDLQGLHGRMKRVSKIYDEILEKIIDDHLLNKQETKKKAADFIDTLMEIMESGEAGFDFDRCHV | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 26,270.054 | ||
| Theoretical pI: | 7.230 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
| Instability index: | 32.192 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.223 | ||
| sheet | 0.296 | ||