| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343045.1 | 5prime_partial | 237 | 850-137(-) |
Amino Acid sequence : | |||
| KKAADFIDTLMEIMESGEAGFDFDRCHVKAVLLDLMIAGTDTTSTTIEWIMSEIMRHPAVMKRLQQELESVVGLDKMVEESHIHKLEYLDCVVKESMRLHPVGPLLIPHESMEDCELEGY YIPKNSRILVNVWAIGRDPNVWPNPELFAPERFIGSDIDLRGRHFELLPFGSGRRGCPGLQLGLTLVKLVVAQFVHCFDWKLPDGMEAADVDMSEHFGLAACRAIHLTAIPVCRLRK* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 10,986.352 | ||
| Theoretical pI: | 9.791 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 48.729 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.363 | ||
Secondary Structure Fraction | |||
| Helix | 0.183 | ||
| turn | 0.413 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343045.1 | complete | 104 | 177-491(+) |
Amino Acid sequence : | |||
| MALHAANPKCSDMSTSAASIPSGSFQSKQCTNCATTNFTNVSPSCSPGQPRLPEPNGKSSKWRPLRSISLPMNLSGANNSGFGQTLGSLPIAHTFTRIREFLGM* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 10,986.352 | ||
| Theoretical pI: | 9.791 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 48.729 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.363 | ||
Secondary Structure Fraction | |||
| Helix | 0.183 | ||
| turn | 0.413 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343045.1 | 5prime_partial | 237 | 850-137(-) |
Amino Acid sequence : | |||
| KKAADFIDTLMEIMESGEAGFDFDRCHVKAVLLDLMIAGTDTTSTTIEWIMSEIMRHPAVMKRLQQELESVVGLDKMVEESHIHKLEYLDCVVKESMRLHPVGPLLIPHESMEDCELEGY YIPKNSRILVNVWAIGRDPNVWPNPELFAPERFIGSDIDLRGRHFELLPFGSGRRGCPGLQLGLTLVKLVVAQFVHCFDWKLPDGMEAADVDMSEHFGLAACRAIHLTAIPVCRLRK* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 10,986.352 | ||
| Theoretical pI: | 9.791 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 48.729 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.363 | ||
Secondary Structure Fraction | |||
| Helix | 0.183 | ||
| turn | 0.413 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343045.1 | complete | 104 | 177-491(+) |
Amino Acid sequence : | |||
| MALHAANPKCSDMSTSAASIPSGSFQSKQCTNCATTNFTNVSPSCSPGQPRLPEPNGKSSKWRPLRSISLPMNLSGANNSGFGQTLGSLPIAHTFTRIREFLGM* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 10,986.352 | ||
| Theoretical pI: | 9.791 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 48.729 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.363 | ||
Secondary Structure Fraction | |||
| Helix | 0.183 | ||
| turn | 0.413 | ||
| sheet | 0.212 | ||