| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343089.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
| CMANCLRMPMASSLCCSSSASVTQPPKRRSFSVVNSAKIPMPPINPKDPFLSRLASLAASSPDTLLNRPKNPDTPPFLDVFDSPQLMATPAQVERSVSYNEHRPRRPPPDLPSLLLHGRI VYIGMPLVPAVTELVVAELMYLQWMDPKEPIYLYINSTGTTRDDGETVGMETEGFAIYDAMMQLKNEIHTVAVGAAIGQACLLLSAGTKGKRFMMPHAKAMIQQPRVPSSGLMPASDVLI RAKEVIINRDTLVKLLAKHTENS | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 13,320.160 | ||
| Theoretical pI: | 7.694 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 56.002 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.189 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.288 | ||
| sheet | 0.360 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343089.1 | 3prime_partial | 125 | 375-1(-) |
Amino Acid sequence : | |||
| MPMYTILPCSNNEGKSGGGLLGLCSLYETDLSTWAGVAMSWGESKTSKNGGVSGFLGLLRRVSGEEAASEARRERKGSLGLIGGMGILALLTTLKLRRLGGCVTEAEEEQQREEAMGIRR QLAIQ | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,320.160 | ||
| Theoretical pI: | 7.694 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 56.002 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.189 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.288 | ||
| sheet | 0.360 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343089.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
| CMANCLRMPMASSLCCSSSASVTQPPKRRSFSVVNSAKIPMPPINPKDPFLSRLASLAASSPDTLLNRPKNPDTPPFLDVFDSPQLMATPAQVERSVSYNEHRPRRPPPDLPSLLLHGRI VYIGMPLVPAVTELVVAELMYLQWMDPKEPIYLYINSTGTTRDDGETVGMETEGFAIYDAMMQLKNEIHTVAVGAAIGQACLLLSAGTKGKRFMMPHAKAMIQQPRVPSSGLMPASDVLI RAKEVIINRDTLVKLLAKHTENS | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 13,320.160 | ||
| Theoretical pI: | 7.694 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 56.002 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.189 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.288 | ||
| sheet | 0.360 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343089.1 | 3prime_partial | 125 | 375-1(-) |
Amino Acid sequence : | |||
| MPMYTILPCSNNEGKSGGGLLGLCSLYETDLSTWAGVAMSWGESKTSKNGGVSGFLGLLRRVSGEEAASEARRERKGSLGLIGGMGILALLTTLKLRRLGGCVTEAEEEQQREEAMGIRR QLAIQ | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,320.160 | ||
| Theoretical pI: | 7.694 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 56.002 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.189 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.288 | ||
| sheet | 0.360 | ||