Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343095.1 | 5prime_partial | 107 | 3-326(+) |
Amino Acid sequence : | |||
SIINMASDVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLESNILWVNPDCGLKTRKYGEVKPALENMVAAAKLLRSQLASAK* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,684.374 | ||
Theoretical pI: | 7.817 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 49.233 | ||
aromaticity | 0.047 | ||
GRAVY | -0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.262 | ||
sheet | 0.290 |