Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343095.1	5prime_partial	107	3-326(+)
Amino Acid sequence :
SIINMASDVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLESNILWVNPDCGLKTRKYGEVKPALENMVAAAKLLRSQLASAK*
Physicochemical properties
Number of amino acids:		107
Molecular weight:		11,684.374
Theoretical pI:		7.817
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		49.233
aromaticity		0.047
GRAVY		-0.107
Secondary Structure Fraction
Helix		0.308
turn		0.262
sheet		0.290