Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343107.1 | 5prime_partial | 249 | 1-750(+) |
Amino Acid sequence : | |||
ADYNIHKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH LVLRLRGGF* | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 15,009.130 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 116.044 | ||
aromaticity | 0.036 | ||
GRAVY | -0.697 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.413 | ||
sheet | 0.152 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343107.1 | 5prime_partial | 138 | 2-418(+) |
Amino Acid sequence : | |||
PTTTSTRNPPSIWSSVSVVACKSSSRPSPGKPSPWRSRAPTPLTMSRRKFRTRKAFPRTSRGLSLPASSSRTAAPLLTITSRRSPPSTLSSVSVVACRSSSRPSPARPSPLRLRALTPST MSRPRSRTRRAFPRISRG* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,009.130 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 116.044 | ||
aromaticity | 0.036 | ||
GRAVY | -0.697 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.413 | ||
sheet | 0.152 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343107.1 | 5prime_partial | 249 | 1-750(+) |
Amino Acid sequence : | |||
ADYNIHKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH LVLRLRGGF* | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 15,009.130 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 116.044 | ||
aromaticity | 0.036 | ||
GRAVY | -0.697 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.413 | ||
sheet | 0.152 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343107.1 | 5prime_partial | 138 | 2-418(+) |
Amino Acid sequence : | |||
PTTTSTRNPPSIWSSVSVVACKSSSRPSPGKPSPWRSRAPTPLTMSRRKFRTRKAFPRTSRGLSLPASSSRTAAPLLTITSRRSPPSTLSSVSVVACRSSSRPSPARPSPLRLRALTPST MSRPRSRTRRAFPRISRG* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,009.130 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 116.044 | ||
aromaticity | 0.036 | ||
GRAVY | -0.697 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.413 | ||
sheet | 0.152 |