| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343113.1 | internal | 264 | 1-792(+) |
Amino Acid sequence : | |||
| TPFLTSNPALLALPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAV FAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPA INVNDSVTKSKFDNLYGCRHSLPD | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 11,428.130 | ||
| Theoretical pI: | 11.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 47.872 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.323 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.287 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343113.1 | 5prime_partial | 254 | 792-28(-) |
Amino Acid sequence : | |||
| IRQRVPATIQVIELALGDRIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIIGRAGVRQLPRLLVLLLRLHALVDQQSGITAVVHDEIGAA ARAPIEGPLGAPPVLLQGLTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAA GGGLLHLERHGKGE* | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 11,428.130 | ||
| Theoretical pI: | 11.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 47.872 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.323 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.287 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343113.1 | 3prime_partial | 101 | 305-3(-) |
Amino Acid sequence : | |||
| MLQEHHLTSAPRAVRVSMRTAVWMVMWRLPVIRAPLKGWEGPNSVRQEMRPGISTSASSISRRPKSAWDMSLTLYSRPEVVFSTWSAMGRASRAGFEVRNG | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,428.130 | ||
| Theoretical pI: | 11.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 47.872 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.323 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.287 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343113.1 | internal | 264 | 1-792(+) |
Amino Acid sequence : | |||
| TPFLTSNPALLALPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAV FAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPA INVNDSVTKSKFDNLYGCRHSLPD | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 11,428.130 | ||
| Theoretical pI: | 11.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 47.872 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.323 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.287 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343113.1 | 5prime_partial | 254 | 792-28(-) |
Amino Acid sequence : | |||
| IRQRVPATIQVIELALGDRIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIIGRAGVRQLPRLLVLLLRLHALVDQQSGITAVVHDEIGAA ARAPIEGPLGAPPVLLQGLTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAA GGGLLHLERHGKGE* | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 11,428.130 | ||
| Theoretical pI: | 11.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 47.872 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.323 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.287 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343113.1 | 3prime_partial | 101 | 305-3(-) |
Amino Acid sequence : | |||
| MLQEHHLTSAPRAVRVSMRTAVWMVMWRLPVIRAPLKGWEGPNSVRQEMRPGISTSASSISRRPKSAWDMSLTLYSRPEVVFSTWSAMGRASRAGFEVRNG | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,428.130 | ||
| Theoretical pI: | 11.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 47.872 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.323 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.287 | ||
| sheet | 0.267 | ||