| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343115.1 | internal | 249 | 3-749(+) |
Amino Acid sequence : | |||
| LFSPSIPGKSHRDAMRLHEEMAVDLINVKPGDRILDAGCGVGGPMRAIAAHSGANVVGITINEYQVKRARAHNKKAGLDKLCEVVCGNFLEMPFADNSFDGAYSIEATCHAPKLEDVYGE IYRVLKPGAYYVSYEWVTTELYHGDNAEHVEVIQGIERGDALPGLRSYSDIAAVAKKVGFEVVKEKDLAKPPSQPWWTRLKMGRIAYWRNHILVTVLAWLGIAPKGVVDVHEMLFVTADY LTRGGESGI | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 20,057.579 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21470 | ||
| Instability index: | 137.397 | ||
| aromaticity | 0.044 | ||
| GRAVY | -1.065 | ||
Secondary Structure Fraction | |||
| Helix | 0.122 | ||
| turn | 0.372 | ||
| sheet | 0.156 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343115.1 | 5prime_partial | 180 | 750-208(-) |
Amino Acid sequence : | |||
| RSRSRRLWLDNPPSQTAFHAHPPRPWARFPATPAPSPECGSSNTRSYPSSAASTTAATAASPNLSPSPPQTLPSSPRRRCRCSSAALAVRRPSRSPVSPPRAPRCRRGIAPSSPTRTTRS TRRVLEPCRSRRRRPPASARGTWPRSSTRRRSCCRRTASRGSCRRRLHRVYRVQPSYCVP* | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 20,057.579 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21470 | ||
| Instability index: | 137.397 | ||
| aromaticity | 0.044 | ||
| GRAVY | -1.065 | ||
Secondary Structure Fraction | |||
| Helix | 0.122 | ||
| turn | 0.372 | ||
| sheet | 0.156 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343115.1 | internal | 249 | 3-749(+) |
Amino Acid sequence : | |||
| LFSPSIPGKSHRDAMRLHEEMAVDLINVKPGDRILDAGCGVGGPMRAIAAHSGANVVGITINEYQVKRARAHNKKAGLDKLCEVVCGNFLEMPFADNSFDGAYSIEATCHAPKLEDVYGE IYRVLKPGAYYVSYEWVTTELYHGDNAEHVEVIQGIERGDALPGLRSYSDIAAVAKKVGFEVVKEKDLAKPPSQPWWTRLKMGRIAYWRNHILVTVLAWLGIAPKGVVDVHEMLFVTADY LTRGGESGI | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 20,057.579 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21470 | ||
| Instability index: | 137.397 | ||
| aromaticity | 0.044 | ||
| GRAVY | -1.065 | ||
Secondary Structure Fraction | |||
| Helix | 0.122 | ||
| turn | 0.372 | ||
| sheet | 0.156 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343115.1 | 5prime_partial | 180 | 750-208(-) |
Amino Acid sequence : | |||
| RSRSRRLWLDNPPSQTAFHAHPPRPWARFPATPAPSPECGSSNTRSYPSSAASTTAATAASPNLSPSPPQTLPSSPRRRCRCSSAALAVRRPSRSPVSPPRAPRCRRGIAPSSPTRTTRS TRRVLEPCRSRRRRPPASARGTWPRSSTRRRSCCRRTASRGSCRRRLHRVYRVQPSYCVP* | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 20,057.579 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21470 | ||
| Instability index: | 137.397 | ||
| aromaticity | 0.044 | ||
| GRAVY | -1.065 | ||
Secondary Structure Fraction | |||
| Helix | 0.122 | ||
| turn | 0.372 | ||
| sheet | 0.156 | ||