Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343123.1 | internal | 224 | 2-673(+) |
Amino Acid sequence : | |||
HFYSLNSILLCGLRPGAAILLIQKFDIAPFLELIQRYKVTIGPFVPPMVLAIAKSPVVDKYDLSSVRTVMSGAAPLGKELEEAVRNKFPNAKLGQGYGMTEAGPVLAMCLAFAKEPFEIK SGSCGTVVRNAQMKIVDPETATSLGRNQPGEICIRGDQIMKGYLNDPEATERTIDKEGWLHTGDIGFIDDDDELFIIDRLKEIIKYKGYHVAPAEIEPLLLNHP | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 24,642.347 | ||
Theoretical pI: | 5.457 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
Instability index: | 38.524 | ||
aromaticity | 0.076 | ||
GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.228 | ||
sheet | 0.281 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343123.1 | internal | 224 | 2-673(+) |
Amino Acid sequence : | |||
HFYSLNSILLCGLRPGAAILLIQKFDIAPFLELIQRYKVTIGPFVPPMVLAIAKSPVVDKYDLSSVRTVMSGAAPLGKELEEAVRNKFPNAKLGQGYGMTEAGPVLAMCLAFAKEPFEIK SGSCGTVVRNAQMKIVDPETATSLGRNQPGEICIRGDQIMKGYLNDPEATERTIDKEGWLHTGDIGFIDDDDELFIIDRLKEIIKYKGYHVAPAEIEPLLLNHP | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 24,642.347 | ||
Theoretical pI: | 5.457 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
Instability index: | 38.524 | ||
aromaticity | 0.076 | ||
GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.228 | ||
sheet | 0.281 |