Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343126.1 | internal | 173 | 1-519(+) |
Amino Acid sequence : | |||
QXSDLISGDEHDLPAVEFSPDDVVALPYSSGTTGLPKGVMLTHKGLVTSVAQQVDGENPNLYIHSDDVIICVLPFFHIYSLNSILLCGLRSGAAILLIQKFDIAPFLELIQRYKVTIGPF VPPMVLAIAKSPVVDKYDLSSVRTAMSGAAPLGKELEEAVRNKFPNRQAWTGL | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 18,632.326 | ||
Theoretical pI: | 5.249 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 45.182 | ||
aromaticity | 0.076 | ||
GRAVY | 0.219 | ||
Secondary Structure Fraction | |||
Helix | 0.360 | ||
turn | 0.256 | ||
sheet | 0.256 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343126.1 | internal | 173 | 1-519(+) |
Amino Acid sequence : | |||
QXSDLISGDEHDLPAVEFSPDDVVALPYSSGTTGLPKGVMLTHKGLVTSVAQQVDGENPNLYIHSDDVIICVLPFFHIYSLNSILLCGLRSGAAILLIQKFDIAPFLELIQRYKVTIGPF VPPMVLAIAKSPVVDKYDLSSVRTAMSGAAPLGKELEEAVRNKFPNRQAWTGL | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 18,632.326 | ||
Theoretical pI: | 5.249 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 45.182 | ||
aromaticity | 0.076 | ||
GRAVY | 0.219 | ||
Secondary Structure Fraction | |||
Helix | 0.360 | ||
turn | 0.256 | ||
sheet | 0.256 |