| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343126.1 | internal | 173 | 1-519(+) |
Amino Acid sequence : | |||
| QXSDLISGDEHDLPAVEFSPDDVVALPYSSGTTGLPKGVMLTHKGLVTSVAQQVDGENPNLYIHSDDVIICVLPFFHIYSLNSILLCGLRSGAAILLIQKFDIAPFLELIQRYKVTIGPF VPPMVLAIAKSPVVDKYDLSSVRTAMSGAAPLGKELEEAVRNKFPNRQAWTGL | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 18,632.326 | ||
| Theoretical pI: | 5.249 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 45.182 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.219 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.256 | ||
| sheet | 0.256 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343126.1 | internal | 173 | 1-519(+) |
Amino Acid sequence : | |||
| QXSDLISGDEHDLPAVEFSPDDVVALPYSSGTTGLPKGVMLTHKGLVTSVAQQVDGENPNLYIHSDDVIICVLPFFHIYSLNSILLCGLRSGAAILLIQKFDIAPFLELIQRYKVTIGPF VPPMVLAIAKSPVVDKYDLSSVRTAMSGAAPLGKELEEAVRNKFPNRQAWTGL | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 18,632.326 | ||
| Theoretical pI: | 5.249 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 45.182 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.219 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.256 | ||
| sheet | 0.256 | ||