Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343132.1 | complete | 178 | 235-771(+) |
Amino Acid sequence : | |||
MYTGMFVYCGKKANLVVGNVLPLRSIPEGAVVCNVEHHVGDRGVFARASGDYAIVISHNPDNGTTRIKLPSGAKKIVPSGCRAMVGQVAGGGRTEKPMLKAGNAYHKFRVKRNSWPKVRG VAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRLRGQAAATAAKEKA* | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 18,680.943 | ||
Theoretical pI: | 9.379 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 73.631 | ||
aromaticity | 0.045 | ||
GRAVY | -0.232 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.335 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343132.1 | 5prime_partial | 176 | 2-532(+) |
Amino Acid sequence : | |||
YNGHRERERDRCSSPTPTTGRARLDSALSTSASATATSKVSFLRSFTTPAAAPPLPASPSATPSATSTRRSSSSPPRACTPACSSTAVRRPTLSSETSYPLDPFLKELSSATSSTMLVTV AFSLGLLVTMPSSSLTIPIMEPLESSSHQEPKRLFQVDAVPWLVRLPEVDVLKSPC* | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 18,680.943 | ||
Theoretical pI: | 9.379 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 73.631 | ||
aromaticity | 0.045 | ||
GRAVY | -0.232 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.335 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343132.1 | complete | 178 | 235-771(+) |
Amino Acid sequence : | |||
MYTGMFVYCGKKANLVVGNVLPLRSIPEGAVVCNVEHHVGDRGVFARASGDYAIVISHNPDNGTTRIKLPSGAKKIVPSGCRAMVGQVAGGGRTEKPMLKAGNAYHKFRVKRNSWPKVRG VAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRLRGQAAATAAKEKA* | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 18,680.943 | ||
Theoretical pI: | 9.379 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 73.631 | ||
aromaticity | 0.045 | ||
GRAVY | -0.232 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.335 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343132.1 | 5prime_partial | 176 | 2-532(+) |
Amino Acid sequence : | |||
YNGHRERERDRCSSPTPTTGRARLDSALSTSASATATSKVSFLRSFTTPAAAPPLPASPSATPSATSTRRSSSSPPRACTPACSSTAVRRPTLSSETSYPLDPFLKELSSATSSTMLVTV AFSLGLLVTMPSSSLTIPIMEPLESSSHQEPKRLFQVDAVPWLVRLPEVDVLKSPC* | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 18,680.943 | ||
Theoretical pI: | 9.379 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 73.631 | ||
aromaticity | 0.045 | ||
GRAVY | -0.232 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.335 | ||
sheet | 0.261 |