Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343134.1 | 5prime_partial | 214 | 3-647(+) |
Amino Acid sequence : | |||
RAEFGTRAATSISNANLVSTWKPSKIKSLGFQSFQPLNFRRLKQNNRKLKVVKASSSGLYSAEQLELTVENVDKVLENVRPYLIADGGNVDVVSVENGVVSLQLQGACGSCPSSTTTMKM GIERVLKEKFGDAIKDICQVNDEQQITETTVEAVNRHLDVLRPAIKNYGGSVEVLSVEGGDCTVRYVGPDSIGSGIKAAIKERFPDIVNVEFTN* | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 11,510.050 | ||
Theoretical pI: | 4.998 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 38.894 | ||
aromaticity | 0.099 | ||
GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.396 | ||
turn | 0.198 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343134.1 | complete | 130 | 496-104(-) |
Amino Acid sequence : | |||
MAGLSTSRWRFTASTVVSVICCSSFTWHISLMASPNFSLRTLSIPIFMVVVELGQLPHAPWSWSDTTPFSTDTTSTFPPSAMRYGRTFSRTLSTFSTVSSSCSAEYNPDEDAFTTFNFRL FCFSRLKLSG* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 11,510.050 | ||
Theoretical pI: | 4.998 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 38.894 | ||
aromaticity | 0.099 | ||
GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.396 | ||
turn | 0.198 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343134.1 | complete | 101 | 473-168(-) |
Amino Acid sequence : | |||
MAVYCLNCGFSDLLLIIHLAYIFDGISKFLLENSLDPHFHGGRRTRTASTCPLELERYDAVLDRHNIDIPAVGDEVRPDVLENLVYVFYGELELLGRVQSR* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,510.050 | ||
Theoretical pI: | 4.998 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 38.894 | ||
aromaticity | 0.099 | ||
GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.396 | ||
turn | 0.198 | ||
sheet | 0.287 |