| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343136.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
| GHGHDKDKDHALDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFSKDTNQQKFLPRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIEEC EEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPSNKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVLK VKPGTVPVCHYLPENHIVWV | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 13,866.304 | ||
| Theoretical pI: | 10.133 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
| Instability index: | 78.676 | ||
| aromaticity | 0.055 | ||
| GRAVY | -1.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.134 | ||
| turn | 0.402 | ||
| sheet | 0.157 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343136.1 | 5prime_partial | 127 | 783-400(-) |
Amino Acid sequence : | |||
| KPTQCDSQGDNGRLAQSLASPSTPEKPNASDSTPPCPYGTPPQPQPLTRRPPREKHRRPPSSQSCGSKTQHTHTPAGGTRPPACYSASSTLPRYGTLSSPNYALLSTLLRRCSLFSTWRN RPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,866.304 | ||
| Theoretical pI: | 10.133 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
| Instability index: | 78.676 | ||
| aromaticity | 0.055 | ||
| GRAVY | -1.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.134 | ||
| turn | 0.402 | ||
| sheet | 0.157 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343136.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
| GHGHDKDKDHALDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFSKDTNQQKFLPRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIEEC EEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPSNKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVLK VKPGTVPVCHYLPENHIVWV | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 13,866.304 | ||
| Theoretical pI: | 10.133 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
| Instability index: | 78.676 | ||
| aromaticity | 0.055 | ||
| GRAVY | -1.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.134 | ||
| turn | 0.402 | ||
| sheet | 0.157 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343136.1 | 5prime_partial | 127 | 783-400(-) |
Amino Acid sequence : | |||
| KPTQCDSQGDNGRLAQSLASPSTPEKPNASDSTPPCPYGTPPQPQPLTRRPPREKHRRPPSSQSCGSKTQHTHTPAGGTRPPACYSASSTLPRYGTLSSPNYALLSTLLRRCSLFSTWRN RPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,866.304 | ||
| Theoretical pI: | 10.133 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
| Instability index: | 78.676 | ||
| aromaticity | 0.055 | ||
| GRAVY | -1.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.134 | ||
| turn | 0.402 | ||
| sheet | 0.157 | ||