Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343140.1 | 5prime_partial | 189 | 3-572(+) |
Amino Acid sequence : | |||
TLLPSLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSVMDGYNL PIEMTPTTNGCTRSVKCAAEDIVANCPNRLKVDGGCQNPCTEFKTTEYCCHAGECRPTDMSRFFKIALP* | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 12,159.269 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 90.190 | ||
aromaticity | 0.016 | ||
GRAVY | -0.732 | ||
Secondary Structure Fraction | |||
Helix | 0.056 | ||
turn | 0.476 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343140.1 | 5prime_partial | 128 | 2-388(+) |
Amino Acid sequence : | |||
HSPPFPPPPPRRHRHPLRHPKQMLLHDLAGRPPPRRRPPPRQRPNLDPILPKRPQTRQSLGPHQLHLRFLRQGQMPHRRLRRPTQLHHLRLAAAHQGGVRPQRLRAEGLLRRLRHGRLQS ADRDDADD* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 12,159.269 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 90.190 | ||
aromaticity | 0.016 | ||
GRAVY | -0.732 | ||
Secondary Structure Fraction | |||
Helix | 0.056 | ||
turn | 0.476 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343140.1 | 5prime_partial | 124 | 1-375(+) |
Amino Acid sequence : | |||
PLSSLPSSSSTPPPPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPSIPPARANASPAIAAANSTAPPSARRRTPRRSTASTTSGGRTTTTSPSWTATI CRSR* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 12,159.269 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 90.190 | ||
aromaticity | 0.016 | ||
GRAVY | -0.732 | ||
Secondary Structure Fraction | |||
Helix | 0.056 | ||
turn | 0.476 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343140.1 | 5prime_partial | 189 | 3-572(+) |
Amino Acid sequence : | |||
TLLPSLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSVMDGYNL PIEMTPTTNGCTRSVKCAAEDIVANCPNRLKVDGGCQNPCTEFKTTEYCCHAGECRPTDMSRFFKIALP* | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 12,159.269 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 90.190 | ||
aromaticity | 0.016 | ||
GRAVY | -0.732 | ||
Secondary Structure Fraction | |||
Helix | 0.056 | ||
turn | 0.476 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343140.1 | 5prime_partial | 128 | 2-388(+) |
Amino Acid sequence : | |||
HSPPFPPPPPRRHRHPLRHPKQMLLHDLAGRPPPRRRPPPRQRPNLDPILPKRPQTRQSLGPHQLHLRFLRQGQMPHRRLRRPTQLHHLRLAAAHQGGVRPQRLRAEGLLRRLRHGRLQS ADRDDADD* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 12,159.269 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 90.190 | ||
aromaticity | 0.016 | ||
GRAVY | -0.732 | ||
Secondary Structure Fraction | |||
Helix | 0.056 | ||
turn | 0.476 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343140.1 | 5prime_partial | 124 | 1-375(+) |
Amino Acid sequence : | |||
PLSSLPSSSSTPPPPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPSIPPARANASPAIAAANSTAPPSARRRTPRRSTASTTSGGRTTTTSPSWTATI CRSR* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 12,159.269 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 90.190 | ||
aromaticity | 0.016 | ||
GRAVY | -0.732 | ||
Secondary Structure Fraction | |||
Helix | 0.056 | ||
turn | 0.476 | ||
sheet | 0.202 |