| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343140.1 | 5prime_partial | 189 | 3-572(+) |
Amino Acid sequence : | |||
| TLLPSLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSVMDGYNL PIEMTPTTNGCTRSVKCAAEDIVANCPNRLKVDGGCQNPCTEFKTTEYCCHAGECRPTDMSRFFKIALP* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 12,159.269 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 90.190 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.732 | ||
Secondary Structure Fraction | |||
| Helix | 0.056 | ||
| turn | 0.476 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343140.1 | 5prime_partial | 128 | 2-388(+) |
Amino Acid sequence : | |||
| HSPPFPPPPPRRHRHPLRHPKQMLLHDLAGRPPPRRRPPPRQRPNLDPILPKRPQTRQSLGPHQLHLRFLRQGQMPHRRLRRPTQLHHLRLAAAHQGGVRPQRLRAEGLLRRLRHGRLQS ADRDDADD* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 12,159.269 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 90.190 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.732 | ||
Secondary Structure Fraction | |||
| Helix | 0.056 | ||
| turn | 0.476 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343140.1 | 5prime_partial | 124 | 1-375(+) |
Amino Acid sequence : | |||
| PLSSLPSSSSTPPPPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPSIPPARANASPAIAAANSTAPPSARRRTPRRSTASTTSGGRTTTTSPSWTATI CRSR* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 12,159.269 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 90.190 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.732 | ||
Secondary Structure Fraction | |||
| Helix | 0.056 | ||
| turn | 0.476 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343140.1 | 5prime_partial | 189 | 3-572(+) |
Amino Acid sequence : | |||
| TLLPSLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSVMDGYNL PIEMTPTTNGCTRSVKCAAEDIVANCPNRLKVDGGCQNPCTEFKTTEYCCHAGECRPTDMSRFFKIALP* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 12,159.269 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 90.190 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.732 | ||
Secondary Structure Fraction | |||
| Helix | 0.056 | ||
| turn | 0.476 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343140.1 | 5prime_partial | 128 | 2-388(+) |
Amino Acid sequence : | |||
| HSPPFPPPPPRRHRHPLRHPKQMLLHDLAGRPPPRRRPPPRQRPNLDPILPKRPQTRQSLGPHQLHLRFLRQGQMPHRRLRRPTQLHHLRLAAAHQGGVRPQRLRAEGLLRRLRHGRLQS ADRDDADD* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 12,159.269 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 90.190 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.732 | ||
Secondary Structure Fraction | |||
| Helix | 0.056 | ||
| turn | 0.476 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343140.1 | 5prime_partial | 124 | 1-375(+) |
Amino Acid sequence : | |||
| PLSSLPSSSSTPPPPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPSIPPARANASPAIAAANSTAPPSARRRTPRRSTASTTSGGRTTTTSPSWTATI CRSR* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 12,159.269 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 90.190 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.732 | ||
Secondary Structure Fraction | |||
| Helix | 0.056 | ||
| turn | 0.476 | ||
| sheet | 0.202 | ||