Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343142.1 | 5prime_partial | 212 | 2-640(+) |
Amino Acid sequence : | |||
LFVLEKDLYAGNKMPLQFSKDTNQQKFLPRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGV SRKPSNKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
Number of amino acids: | 212 | ||
Molecular weight: | 21,117.233 | ||
Theoretical pI: | 9.950 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23295 | ||
Instability index: | 72.634 | ||
aromaticity | 0.074 | ||
GRAVY | -1.168 | ||
Secondary Structure Fraction | |||
Helix | 0.165 | ||
turn | 0.367 | ||
sheet | 0.133 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343142.1 | 5prime_partial | 188 | 812-246(-) |
Amino Acid sequence : | |||
FIDSFPPERKTSHHNNFTNRTYHTHRQISDSQEYVKNTCTHILKSKPHIKTMLNYYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASDSTPPCPYGTPPQPQPLTRRPPREKHRRP PSSQSCGSKTQHTHTPAGGTRPPACYSASSTLPRYGTLSSPNYALLSTLLRRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 21,117.233 | ||
Theoretical pI: | 9.950 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23295 | ||
Instability index: | 72.634 | ||
aromaticity | 0.074 | ||
GRAVY | -1.168 | ||
Secondary Structure Fraction | |||
Helix | 0.165 | ||
turn | 0.367 | ||
sheet | 0.133 |