Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343154.1 | complete | 128 | 795-409(-) |
Amino Acid sequence : | |||
MDAVVLNSQLKNFTLLRVIADEEEEGGEITAPITTNRHLPTSLCPLKEEAFLYTTSSLFCRLSNHIAYRTSLLFGCLHERILCSYQACNCLLTRLLKFTGNQNFIQYIVSLMKIKDQVQF TDTSKVAV* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,349.435 | ||
Theoretical pI: | 5.161 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17670 | ||
Instability index: | 44.149 | ||
aromaticity | 0.113 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.379 | ||
turn | 0.137 | ||
sheet | 0.323 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343154.1 | complete | 124 | 250-624(+) |
Amino Acid sequence : | |||
MILTRAPKLCNFVEWRGYKVVYKRYASLYFCMCIDENDNELEILEIIHHYVEILDRYFGSVCELDLIFNFHKAYYILDEILIAGELQESSKKTVARLIAAQDSLVEAAKEQASSISNMIA QATK* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 14,349.435 | ||
Theoretical pI: | 5.161 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17670 | ||
Instability index: | 44.149 | ||
aromaticity | 0.113 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.379 | ||
turn | 0.137 | ||
sheet | 0.323 |