| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343172.1 | internal | 259 | 3-779(+) |
Amino Acid sequence : | |||
| FLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFA WKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAIN VNDSVTKSKFDNLYGCRHS | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 25,934.868 | ||
| Theoretical pI: | 4.729 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 40.518 | ||
| aromaticity | 0.024 | ||
| GRAVY | 0.074 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.283 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343172.1 | 5prime_partial | 251 | 779-24(-) |
Amino Acid sequence : | |||
| RVAASVQVIELALGDGIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDALVNQQRGITAVVDDEIGAAARP PIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAARGG LLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 25,934.868 | ||
| Theoretical pI: | 4.729 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 40.518 | ||
| aromaticity | 0.024 | ||
| GRAVY | 0.074 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.283 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343172.1 | internal | 259 | 3-779(+) |
Amino Acid sequence : | |||
| FLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFA WKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAIN VNDSVTKSKFDNLYGCRHS | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 25,934.868 | ||
| Theoretical pI: | 4.729 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 40.518 | ||
| aromaticity | 0.024 | ||
| GRAVY | 0.074 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.283 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343172.1 | 5prime_partial | 251 | 779-24(-) |
Amino Acid sequence : | |||
| RVAASVQVIELALGDGIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDALVNQQRGITAVVDDEIGAAARP PIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAARGG LLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 25,934.868 | ||
| Theoretical pI: | 4.729 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 40.518 | ||
| aromaticity | 0.024 | ||
| GRAVY | 0.074 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.283 | ||
| sheet | 0.331 | ||