| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343177.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
| EREMAPCGALRTAFLPSLLHSHRTTAALPTKPQKFSVGAALQHDNTNDISSVASQEPKPLTFTGEKPSTPILDTINFPNHMKNLSIEELEKLCDELREEIVYTVSKTGGHLSSSLGVSEL TVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRQTFGLAGFPKRDESPHDAFGAGHSSTSISAGLGMAVGRDLLNKNNHVISVIGDGAMTAGQAYEALNNAGFLDANLIVVLN DNKQVSLP | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 26,789.953 | ||
| Theoretical pI: | 6.359 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 41.206 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.274 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.274 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343177.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
| EREMAPCGALRTAFLPSLLHSHRTTAALPTKPQKFSVGAALQHDNTNDISSVASQEPKPLTFTGEKPSTPILDTINFPNHMKNLSIEELEKLCDELREEIVYTVSKTGGHLSSSLGVSEL TVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRQTFGLAGFPKRDESPHDAFGAGHSSTSISAGLGMAVGRDLLNKNNHVISVIGDGAMTAGQAYEALNNAGFLDANLIVVLN DNKQVSLP | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 26,789.953 | ||
| Theoretical pI: | 6.359 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 41.206 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.274 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.274 | ||
| sheet | 0.262 | ||