| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343191.1 | 5prime_partial | 191 | 762-187(-) |
Amino Acid sequence : | |||
| GEVCVRGDTLFSGYYKRDDLTKEVFIDGWFHTGDIGQWQKDGSLKIIDRKKNIFKLSQGEYVAVENLENVYGLVPAIDSIWVYGNSFESCLVAVVNPRKQAVEEWAAEAGVSGDFESLCE NQKVKEYIVSELARVGKEKKLKGFEFIKAVHLDPVPFDMERALITPPFKKKRPQLLKFYQNAIDNLYKSLK* | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,818.755 | ||
| Theoretical pI: | 6.938 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
| Instability index: | 22.010 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.346 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.204 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343191.1 | 5prime_partial | 191 | 762-187(-) |
Amino Acid sequence : | |||
| GEVCVRGDTLFSGYYKRDDLTKEVFIDGWFHTGDIGQWQKDGSLKIIDRKKNIFKLSQGEYVAVENLENVYGLVPAIDSIWVYGNSFESCLVAVVNPRKQAVEEWAAEAGVSGDFESLCE NQKVKEYIVSELARVGKEKKLKGFEFIKAVHLDPVPFDMERALITPPFKKKRPQLLKFYQNAIDNLYKSLK* | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,818.755 | ||
| Theoretical pI: | 6.938 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
| Instability index: | 22.010 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.346 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.204 | ||
| sheet | 0.230 | ||