Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343191.1 | 5prime_partial | 191 | 762-187(-) |
Amino Acid sequence : | |||
GEVCVRGDTLFSGYYKRDDLTKEVFIDGWFHTGDIGQWQKDGSLKIIDRKKNIFKLSQGEYVAVENLENVYGLVPAIDSIWVYGNSFESCLVAVVNPRKQAVEEWAAEAGVSGDFESLCE NQKVKEYIVSELARVGKEKKLKGFEFIKAVHLDPVPFDMERALITPPFKKKRPQLLKFYQNAIDNLYKSLK* | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 21,818.755 | ||
Theoretical pI: | 6.938 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
Instability index: | 22.010 | ||
aromaticity | 0.120 | ||
GRAVY | -0.346 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.204 | ||
sheet | 0.230 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343191.1 | 5prime_partial | 191 | 762-187(-) |
Amino Acid sequence : | |||
GEVCVRGDTLFSGYYKRDDLTKEVFIDGWFHTGDIGQWQKDGSLKIIDRKKNIFKLSQGEYVAVENLENVYGLVPAIDSIWVYGNSFESCLVAVVNPRKQAVEEWAAEAGVSGDFESLCE NQKVKEYIVSELARVGKEKKLKGFEFIKAVHLDPVPFDMERALITPPFKKKRPQLLKFYQNAIDNLYKSLK* | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 21,818.755 | ||
Theoretical pI: | 6.938 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
Instability index: | 22.010 | ||
aromaticity | 0.120 | ||
GRAVY | -0.346 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.204 | ||
sheet | 0.230 |