| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343192.1 | 5prime_partial | 173 | 3-524(+) |
Amino Acid sequence : | |||
| ILTRASYEWVMMNKETRRLSKIPDEVRGEIGRYFVDSPPLVDDDTRKLPKLDENTAEYIRTGLTPRWSDLDVNQHVNNVKYVGWILESAPLEILETHELVGMTLEYRRECMRDSVLQSLT SIVDGETSNPGFVECQHLLRLEGGGEIVKGRTKWRPKFVDKVASLGELPEENA* | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,844.292 | ||
| Theoretical pI: | 5.105 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 38.047 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.529 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.220 | ||
| sheet | 0.272 | ||