| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343199.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
| DEMLTPEQIPLKRKQLFIKSTSDARQQKKQKQLEEELEKERQKKLEEDRRLENPEQYLEELRAKHRDLFEKVEQRKRLKTNGGNSNGNQNGSGGVGRGERLNSSQRERMRLLTTAAFDRG KGEDTFGARDEDWQLYKLMSRDNDDDDDDGQDPDEAELARISSRLQEIDPTFFKVEPGSSSSEAPRFRPLTKEDFQIILGVERFRCPEILFNPNLIGIDQAGLDEMVGVCMRRMPWKDKR ITDSILLTGGSCLFPGMRER | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 30,136.441 | ||
| Theoretical pI: | 5.367 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 49.457 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.223 | ||
| turn | 0.219 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343199.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
| DEMLTPEQIPLKRKQLFIKSTSDARQQKKQKQLEEELEKERQKKLEEDRRLENPEQYLEELRAKHRDLFEKVEQRKRLKTNGGNSNGNQNGSGGVGRGERLNSSQRERMRLLTTAAFDRG KGEDTFGARDEDWQLYKLMSRDNDDDDDDGQDPDEAELARISSRLQEIDPTFFKVEPGSSSSEAPRFRPLTKEDFQIILGVERFRCPEILFNPNLIGIDQAGLDEMVGVCMRRMPWKDKR ITDSILLTGGSCLFPGMRER | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 30,136.441 | ||
| Theoretical pI: | 5.367 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 49.457 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.223 | ||
| turn | 0.219 | ||
| sheet | 0.273 | ||