Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343201.1 | 5prime_partial | 162 | 2-490(+) |
Amino Acid sequence : | |||
KKPNRTYLPQNHLRRREMSSEQIESHRANAEVYTGDAVCKQKSIELLEKINMPKGLLPLDDIVEVGHNAETGFVWLKLKKSKTHYFKGIGRSVWYDTEVTAFVSDRRMKRLTGVKSKEIL IWITICDISIKDPESGKITFGTPTGISRAFPVSAFEEEEEKK* | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 18,568.134 | ||
Theoretical pI: | 9.167 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 58.972 | ||
aromaticity | 0.080 | ||
GRAVY | -0.583 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.210 | ||
sheet | 0.228 |