Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343205.1 | 5prime_partial | 192 | 749-171(-) |
Amino Acid sequence : | |||
GSITVLNTAQFRELALGLELAGRPFLWVVRRDSAGEGLFPAGFEARVGRRGKVLGWAPQQEVLAPPSVACFISHCGWNSTVEGVSSGVPFLCWPYFADQFCNQDYICDEWKVGLRLEKGE NGIVTREEVKEKIESLVGDGGFKERALNLRARVMDGVRGGKSHANFTNFVDWIHKTQSHCEVKNSCLVSKGK* | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 18,644.437 | ||
Theoretical pI: | 10.703 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 65.916 | ||
aromaticity | 0.042 | ||
GRAVY | -0.622 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.321 | ||
sheet | 0.206 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343205.1 | complete | 165 | 213-710(+) |
Amino Acid sequence : | |||
MRLGLMDPIHEISKIRMGFSSSNTIHNSRSKIQSPLLKPSITDKTLNFFLHFFSGHDPIFTLLQSQSDLPLIANIVLITELIREIRPAQKRHPTTNPLDSRIPPTMTYKTRHRRGGQHLL LRGPPQNLPPPPHPRLEPCRKKSLSGGVPPHHPQKRPAGELEPEG* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 18,644.437 | ||
Theoretical pI: | 10.703 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 65.916 | ||
aromaticity | 0.042 | ||
GRAVY | -0.622 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.321 | ||
sheet | 0.206 |