| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343219.1 | internal | 251 | 2-754(+) |
Amino Acid sequence : | |||
| DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYDYERIRKVCNKQKAVLLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRG PRGAMIFFRKGVKEINKQGQEVKYDYEDKINQAVFPGLQGGPHNHTISGLAVALKQAMTPEYKAYQEQVLSNCSKFAEALLERGYDLVSGGTENHLVLVNLRKKGIDGSRVEKVLEAVHI AAHKNTVPGDV | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 27,705.316 | ||
| Theoretical pI: | 8.663 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19370 19495 | ||
| Instability index: | 32.793 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.281 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.211 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343219.1 | internal | 251 | 2-754(+) |
Amino Acid sequence : | |||
| DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYDYERIRKVCNKQKAVLLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRG PRGAMIFFRKGVKEINKQGQEVKYDYEDKINQAVFPGLQGGPHNHTISGLAVALKQAMTPEYKAYQEQVLSNCSKFAEALLERGYDLVSGGTENHLVLVNLRKKGIDGSRVEKVLEAVHI AAHKNTVPGDV | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 27,705.316 | ||
| Theoretical pI: | 8.663 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19370 19495 | ||
| Instability index: | 32.793 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.281 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.211 | ||
| sheet | 0.255 | ||